PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC004675.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 102aa    MW: 11424 Da    PI: 6.6508
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC004675.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer66.35.6e-214092357
   ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                  +++Y +ClkNh +slG +a+DGC Efmp   +egt++ ++C AC CH nF  +e 
  EcC004675.20 40 NFQYFKCLKNHSVSLGNYAIDGCAEFMPR--DEGTPEFFQCIACCCHLNFNWKEI 92
                  689*************************9..779****************98886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-113892IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.9E-184191IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.2E-174291IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152318.7374391IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
QPKPRIDHLL QPSIPTSSPP SVEFHKITAS TQAMPLRVAN FQYFKCLKNH SVSLGNYAID  60
GCAEFMPRDE GTPEFFQCIA CCCHLNFNWK EIIAHGGSEL ES
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010026173.11e-43PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9SB613e-15ZHD2_ARATH; Zinc-finger homeodomain protein 2
STRINGGLYMA16G25280.21e-14(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-16homeobox protein 22